datasets.digitalmarketingservicesnewyork.com
Without any need to download, a variety of popular machine learning datasets can be accessed and streamed with Deep Lake with one line of code. This enables
Top-level Domain
Server Location
IP Addresses
About datasets.digitalmarketingservicesnewyork.com
datasets.digitalmarketingservicesnewyork.com is a subdomain of Digitalmarketingservicesnewyork.com. The hostname is associated with the IPv4 address 156.67.70.2, as well as the IPv6 address and 2a02:4780:b:625:0:376b:1f6d:f. The site has its servers located in the United States and is run by the "LiteSpeed" webserver software.
Trace an Email Address
datasets.Digitalmarketingservicesnewyork.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
United States
datasets.Digitalmarketingservicesnewyork.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
Datasets - Machine Learning Datasets
Description
Without any need to download, a variety of popular machine learning datasets can be accessed and streamed with Deep Lake with one line of code. This enables
Website Host
Main Language
n/a
Inbound Links
n/a
datasets.Digitalmarketingservicesnewyork.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
datasets.Digitalmarketingservicesnewyork.com DNS Resource Records
Unlock the full potential of the subdomain with a comprehensive review of its DNS configuration, including A, AAAA, CNAME, and TXT records.
A Records
datasets IN A 156.67.70.2
AAAA Records
datasets IN AAAA 2a02:4780:b:625:0:376b:1f6d:f
CNAME Records
No CNAME records could be found.
TXT Records
No TXT records could be found.
Similar Domain Names like datasets.Digitalmarketingservicesnewyork.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- https //datasets.digitalmarketingservicesnewyork.com
- http //datasets.digitalmarketingservicesnewyork.com
Datasets Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - datasets.Digitalmarketingservicesnewyork.com Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
What is the subdomain about?
Without any need to download, a variety of popular machine learning datasets can be accessed and streamed with Deep Lake with one line of code. This enables
What is the IP address?
The hostname resolves to the IP addresses 156.67.70.2 and 2a02:4780:b:625:0:376b:1f6d:f.
Where are the server locations?
The site has its servers located in the United States.
What webserver software is used?
The website is powered by "LiteSpeed" webserver.