Ocakkampanialarikapindavarsykacirma.online
Global Traffic Rank
Safety/Trust
Child Safety
Registered
Visitors / Day*
Pageviews / Day*
Website Worth*
Revenue / Day*
About Ocakkampanialarikapindavarsykacirma.online
The domain Ocakkampanialarikapindavarsykacirma.online belongs to the generic Top-level domain .online. It is associated with the IPv4 address 87.248.157.101. The domain has been registered 3 months ago with HOSTINGER operations, UAB on Jan 2024. The site has its servers located in Turkey.
Trace an Email Address
Ocakkampanialarikapindavarsykacirma.online Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
Türkiye
Ocakkampanialarikapindavarsykacirma.online Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Main Language
n/a
Inbound Links
n/a
Ocakkampanialarikapindavarsykacirma.online Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
Ocakkampanialarikapindavarsykacirma.online WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
Domain Registered
Domain Updated
Domain Expiry
WHOIS Server
Domain Status
Nameservers
DNSSEC
Ocakkampanialarikapindavarsykacirma.online DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 87.248.157.101
AAAA Records
No AAAA records could be found.
MX Records
No MX records could be found.
NS Records
@ IN NS ns1.dns-parking.com
@ IN NS ns2.dns-parking.com
TXT Records
No TXT records could be found.
SOA Record
@ IN SOA ns1.dns-parking.com. dns.hostinger.com
(
2024012609 ; serial
10000 ; refresh (2 hours, 46 minutes, 40 seconds)
2400 ; retry (40 minutes)
604800 ; expire (7 days)
600 ; minimum (10 minutes)
)
Similar Domain Names like Ocakkampanialarikapindavarsykacirma.online
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- ocakkampanialarikapindavarsykacirma online
- ocakkampanialarikapindavarsykacirma dot online
- http //ocakkampanialarikapindavarsykacirma.online
- https //ocakkampanialarikapindavarsykacirma.online
Ocakkampanialarikapindavarsykacirma online Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Ocakkampanialarikapindavarsykacirma.online Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
Who is the registrar for the domain?
The domain has been registered at HOSTINGER operations, UAB. You can visit the registrar's website at https://www.hostinger.com/. The registrar's WHOIS server can be reached at whois.hostinger.com.
What is the IP address?
The hostname resolves to the IPv4 address 87.248.157.101.
When did the domain come out?
The domain was registered 98 days ago on Friday, January 26, 2024.
When will the domain expire?
This domain will expire in 268 days on Monday, January 27, 2025.
When was the last WHOIS update?
The WHOIS entry was last updated 98 days ago on Friday, January 26, 2024.
What are the domain's nameservers?
DNS is provided by the nameservers ns1.dns-parking.com and ns2.dns-parking.com.
Where are the server locations?
The site has its servers located in Turkey.