Ravenhawksmagickalmysticalplaces.com

Global Traffic Rank

> 1M

Safety/Trust

Unknown

Child Safety

Unknown

Registered

Jul 2007
16 years old

Visitors / Day*

0 - 10
0 - 10 / month

Pageviews / Day*

0 - 10
0 - 10 / month

Website Worth*

Unknown

Revenue / Day*

Unknown
$0 - 10 / month
*estimated
Information on this page was last updated on

About Ravenhawksmagickalmysticalplaces.com

The domain Ravenhawksmagickalmysticalplaces.com belongs to the generic Top-level domain .com. It is associated with the IPv4 address 50.87.64.66. The domain has been registered 16 years ago with eNom, LLC on Jul 2007. The site has its servers located in the United States and is run by the "Apache" webserver software.

Trace an Email Address

Ravenhawksmagickalmysticalplaces.com Global Traffic Rank History

Explore the website's historical data on Global Traffic Rank and track its ranking trends over time.

Ravenhawksmagickalmysticalplaces.com Server Location

Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!

Flag of the United StatesUnited States

Ravenhawksmagickalmysticalplaces.com Website Information

Uncover the website's purpose and content, complemented by relevant focus keywords.

Ravenhawksmagickalmysticalplaces.com Web Server

Discover essential Web Server Information: server software, page load time, and website language at your fingertips!

Webserver Software

Apache

Median Page Load Time

n/a

Ravenhawksmagickalmysticalplaces.com WHOIS Data

Discover comprehensive domain registration details and more with the accessible Whois data information right here!

Domain Registered

J*6#1FLfA-%u/t|*$svpl 5ModG29e$q!, 2PE=k#J}?<6:00Ccu>B7
16 years, 9 months and 5 days ago

Domain Updated

JuqH@y}[ lS6$i0CHR- 1j5L'g.\W8_6=a:pW, 2nKTxa$0dl\wBt}%*20&O`zmr
3 years, 9 months and 16 days ago

Domain Expiry

Jj^EultYi m6sN[Sl <WJ!egp/aQzE2?V5'0s9WC3(K1;X/{, 20;)x"l{21
2 years, 9 months and 5 days ago

WHOIS Server

whois.enom.com

Domain Status

clienttransferprohibited

Nameservers

ns1.justhost.com[more]

DNSSEC

unsigned

Ravenhawksmagickalmysticalplaces.com DNS Resource Records

Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.

A Records

@  IN  A  50.87.64.66

AAAA Records

No AAAA records could be found.

NS Records

@  IN  NS  ns1.justhost.com
@ IN NS ns2.justhost.com

TXT Records

@  IN  TXT  "v=spf1 +a +mx +ip4:173.254.28.234 +ip4:50.87.64.66 +include:justhost.com ~all"

SOA Record

@  IN SOA  ns1.justhost.com. root.just2024.justhost.com
(
2021051100 ; serial
86400 ; refresh (1 day)
7200 ; retry (2 hours)
3600000 ; expire (41 days, 16 hours)
300 ; minimum (5 minutes)
)

Similar Domain Names like Ravenhawksmagickalmysticalplaces.com

Websites with similar domain names, indicating related or similar web addresses.

Related Keywords

Explore related keywords for the domain name in search engines.

  • http //ravenhawksmagickalmysticalplaces.com
  • ravenhawksmagickalmysticalplaces dot com
  • https //ravenhawksmagickalmysticalplaces.com
  • ravenhawksmagickalmysticalplaces com

Ravenhawksmagickalmysticalplaces com Frequently Asked Questions (FAQ)

Unveiling the Most Asked Questions - Ravenhawksmagickalmysticalplaces.com Demystified!