Ravenhawksmagickalmysticalplaces.com
Global Traffic Rank
Safety/Trust
Child Safety
Registered
Visitors / Day*
Pageviews / Day*
Website Worth*
Revenue / Day*
About Ravenhawksmagickalmysticalplaces.com
The domain Ravenhawksmagickalmysticalplaces.com belongs to the generic Top-level domain .com. It is associated with the IPv4 address 50.87.64.66. The domain has been registered 16 years ago with eNom, LLC on Jul 2007. The site has its servers located in the United States and is run by the "Apache" webserver software.
Trace an Email Address
Ravenhawksmagickalmysticalplaces.com Global Traffic Rank History
Explore the website's historical data on Global Traffic Rank and track its ranking trends over time.
Ravenhawksmagickalmysticalplaces.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
United States
Ravenhawksmagickalmysticalplaces.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
Index of /
Website Host
Main Language
n/a
Inbound Links
6
Ravenhawksmagickalmysticalplaces.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
Ravenhawksmagickalmysticalplaces.com WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
Domain Registered
Domain Updated
Domain Expiry
WHOIS Server
Domain Status
Nameservers
DNSSEC
Ravenhawksmagickalmysticalplaces.com DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 50.87.64.66
AAAA Records
No AAAA records could be found.
MX Records
@ IN MX 0 mail.ravenhawksmagickalmysticalplaces.com
NS Records
@ IN NS ns1.justhost.com
@ IN NS ns2.justhost.com
TXT Records
@ IN TXT "v=spf1 +a +mx +ip4:173.254.28.234 +ip4:50.87.64.66 +include:justhost.com ~all"
SOA Record
@ IN SOA ns1.justhost.com. root.just2024.justhost.com
(
2021051100 ; serial
86400 ; refresh (1 day)
7200 ; retry (2 hours)
3600000 ; expire (41 days, 16 hours)
300 ; minimum (5 minutes)
)
Similar Domain Names like Ravenhawksmagickalmysticalplaces.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- http //ravenhawksmagickalmysticalplaces.com
- ravenhawksmagickalmysticalplaces dot com
- https //ravenhawksmagickalmysticalplaces.com
- ravenhawksmagickalmysticalplaces com
Ravenhawksmagickalmysticalplaces com Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Ravenhawksmagickalmysticalplaces.com Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
Who is the registrar for the domain?
The domain has been registered at eNom, LLC. You can visit the registrar's website at http://www.enomdomains.com. The registrar's WHOIS server can be reached at whois.enom.com.
What is the IP address?
The hostname resolves to the IPv4 address 50.87.64.66.
When did the domain come out?
The domain was registered 6123 days ago on Sunday, July 29, 2007.
When has the domain expired?
This domain has expired 1009 days ago on Thursday, July 29, 2021.
When was the last WHOIS update?
The WHOIS entry was last updated 1385 days ago on Saturday, July 18, 2020.
What are the domain's nameservers?
DNS is provided by the nameservers ns1.justhost.com and ns2.justhost.com.
Where are the server locations?
The site has its servers located in the United States.
What webserver software is used?
The website is powered by "Apache" webserver.