Speakenglishwithtiffaniacademy.com

Global Traffic Rank

> 1M

Safety/Trust

Unknown

Child Safety

Unknown

Registered

Dec 2018
5 years old

Visitors / Day*

510
15K / month

Pageviews / Day*

1K
31K / month

Website Worth*

$6.9K

Revenue / Day*

$0 - 10
$230 / month
*estimated
Information on this page was last updated on

About Speakenglishwithtiffaniacademy.com

The domain Speakenglishwithtiffaniacademy.com belongs to the generic Top-level domain .com. It is associated with the IPv4 addresses 104.21.57.68 and 172.67.189.99, as well as the IPv6 addresses 2606:4700:3031::6815:3944 and 2606:4700:3031::ac43:bd63. The domain has been registered 5 years ago with NameCheap, Inc. on Dec 2018. The site has its servers located in the United States and is run by the "cloudflare" webserver software.

Trace an Email Address

Speakenglishwithtiffaniacademy.com Server Location

Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!

Flag of the United StatesUnited States

Speakenglishwithtiffaniacademy.com Website Information

Uncover the website's purpose and content, complemented by relevant focus keywords.

Speakenglishwithtiffaniacademy.com Web Server

Discover essential Web Server Information: server software, page load time, and website language at your fingertips!

Webserver Software

cloudflare

Median Page Load Time

n/a

Speakenglishwithtiffaniacademy.com WHOIS Data

Discover comprehensive domain registration details and more with the accessible Whois data information right here!

Domain Registered

Dt@UV8sdecB)CH]A^$r:=" 4L8(rMH)>z;&, "*iq;O2{L@WM=J8J0@NG2Q4}hOUiC18sIC
5 years, 5 months and 24 days ago

Domain Updated

N++->dfIWov<xpGL|ofNzt4 !N4,d8LHWW y""z*g(2eO+k]jro%U;N0\_qqb#L-H21
2 years, 6 months and 24 days ago

Domain Expiry

Dec,S*% 8pMQfPn4Ecs4`c,, 2e[2,\>B>C%4a091~YRts\)E42m$V5ZjkNG{&20h@58
1 year, 5 months and 24 days ago

Domain Status

clienttransferprohibited

Nameservers

dilbert.ns.cloudflare.com[more]

DNSSEC

unsigned

Speakenglishwithtiffaniacademy.com DNS Resource Records

Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.

A Records

@  IN  A  104.21.57.68
@ IN A 172.67.189.99

MX Records

No MX records could be found.

NS Records

No NS records could be found.

TXT Records

No TXT records could be found.

SOA Record

No SOA record could be found.

Similar Domain Names like Speakenglishwithtiffaniacademy.com

Websites with similar domain names, indicating related or similar web addresses.

Related Keywords

Explore related keywords for the domain name in search engines.

  • speakenglishwithtiffaniacademy com
  • https //speakenglishwithtiffaniacademy.com
  • http //speakenglishwithtiffaniacademy.com
  • speakenglishwithtiffaniacademy dot com

Speakenglishwithtiffaniacademy.com Frequently Asked Questions (FAQ)

Unveiling the Most Asked Questions - Speakenglishwithtiffaniacademy.com Demystified!

  • Is the site safe, legit and trustworthy?

    Currently we have not enough information to determine whether the site is safe, legit or trustworthy.

  • Is the site safe for children?

    Currently we have not enough information to determine whether the site is safe for kids or not.

  • Who is the registrar for the domain?

    The domain has been registered at NameCheap, Inc. You can visit the registrar's website at http://www.namecheap.com. The registrar's WHOIS server can be reached at whois.namecheap.com.

  • What is the IP address?

    The hostname resolves to 2 IPv4 addresses and 2 IPv6 addresses:

    • 104.21.57.68
    • 172.67.189.99
    • 2606:4700:3031::6815:3944
    • 2606:4700:3031::ac43:bd63

  • When did the domain come out?

    The domain was registered 2002 days ago on Tuesday, December 4, 2018.

  • When has the domain expired?

    This domain has expired 541 days ago on Sunday, December 4, 2022.

  • When was the last WHOIS update?

    The WHOIS entry was last updated 936 days ago on Thursday, November 4, 2021.

  • What are the domain's nameservers?

    DNS is provided by the nameservers dilbert.ns.cloudflare.com and zara.ns.cloudflare.com.

  • How many people visit the site each day?

    The site receives approximately 510 visitors and 1 Thousand page impressions per day.

  • Where are the server locations?

    The site has its servers located in the United States.

  • What webserver software is used?

    The website is powered by "cloudflare" webserver.