Speakenglishwithtiffaniacademy.com
Global Traffic Rank
Safety/Trust
Child Safety
Registered
Visitors / Day*
Pageviews / Day*
Website Worth*
Revenue / Day*
About Speakenglishwithtiffaniacademy.com
The domain Speakenglishwithtiffaniacademy.com belongs to the generic Top-level domain .com. It is associated with the IPv4 addresses 104.21.57.68 and 172.67.189.99, as well as the IPv6 addresses 2606:4700:3031::6815:3944 and 2606:4700:3031::ac43:bd63. The domain has been registered 5 years ago with NameCheap, Inc. on Dec 2018. The site has its servers located in the United States and is run by the "cloudflare" webserver software.
Trace an Email Address
Speakenglishwithtiffaniacademy.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
United States
Speakenglishwithtiffaniacademy.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy
Website Host
Main Language
n/a
Inbound Links
1
Speakenglishwithtiffaniacademy.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
Speakenglishwithtiffaniacademy.com WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
Domain Registered
Domain Updated
Domain Expiry
WHOIS Server
Domain Status
Nameservers
DNSSEC
Speakenglishwithtiffaniacademy.com DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 104.21.57.68
@ IN A 172.67.189.99
AAAA Records
@ IN AAAA 2606:4700:3031::6815:3944
@ IN AAAA 2606:4700:3031::ac43:bd63
MX Records
No MX records could be found.
NS Records
No NS records could be found.
TXT Records
No TXT records could be found.
SOA Record
No SOA record could be found.
Similar Domain Names like Speakenglishwithtiffaniacademy.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- speakenglishwithtiffaniacademy com
- https //speakenglishwithtiffaniacademy.com
- http //speakenglishwithtiffaniacademy.com
- speakenglishwithtiffaniacademy dot com
Speakenglishwithtiffaniacademy.com Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Speakenglishwithtiffaniacademy.com Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
Who is the registrar for the domain?
The domain has been registered at NameCheap, Inc. You can visit the registrar's website at http://www.namecheap.com. The registrar's WHOIS server can be reached at whois.namecheap.com.
What is the IP address?
The hostname resolves to 2 IPv4 addresses and 2 IPv6 addresses:
- 104.21.57.68
- 172.67.189.99
- 2606:4700:3031::6815:3944
- 2606:4700:3031::ac43:bd63
When did the domain come out?
The domain was registered 2002 days ago on Tuesday, December 4, 2018.
When has the domain expired?
This domain has expired 541 days ago on Sunday, December 4, 2022.
When was the last WHOIS update?
The WHOIS entry was last updated 936 days ago on Thursday, November 4, 2021.
What are the domain's nameservers?
DNS is provided by the nameservers dilbert.ns.cloudflare.com and zara.ns.cloudflare.com.
How many people visit the site each day?
The site receives approximately 510 visitors and 1 Thousand page impressions per day.
Where are the server locations?
The site has its servers located in the United States.
What webserver software is used?
The website is powered by "cloudflare" webserver.