Tampaflcriminaldefenselawyers.com
- Global Traffic Rank
- > 1M
- Safety/Trust
- Unknown
- Child Safety
- Unknown
- Registered
- Nov 2010
- 13 years old
- Visitors / Day*
- 0 - 10
- 0 - 10 / month
- Pageviews / Day*
- 0 - 10
- 0 - 10 / month
- Website Worth*
- Unknown
- Revenue / Day*
- Unknown
- $0 - 10 / month
About Tampaflcriminaldefenselawyers.com
The domain Tampaflcriminaldefenselawyers.com belongs to the generic Top-level domain .com. It is associated with the IPv4 addresses 3.33.152.147 and 15.197.142.173. The domain has been registered 13 years ago with GoDaddy.com, LLC on Nov 2010. The site has its servers located in the United States.
Trace an Email Address
Tampaflcriminaldefenselawyers.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
Tampaflcriminaldefenselawyers.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
- Main Language
- n/a
- Inbound Links
- 1
Tampaflcriminaldefenselawyers.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
- Webserver Software
- n/a
- Median Page Load Time
- n/a
Tampaflcriminaldefenselawyers.com WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
- Domain Registered
- Nov M@/L^6SOx8
{FcrVH#$,|Yw2010 - 13 years, 6 months and 24 days ago
- Domain Updated
- Se
c-+Ogc+.N0N<p*z{Br18,;6Itk[/)SZ72022b:m#e}ZmWy - 1 year, 8 months and 24 days ago
- Domain Expiry
- Nov
Ax*AAeF#7]!/>z8~|p*Pc,>Wu7 202eLz3 - 6 months and 24 days ago
- WHOIS Server
- whois.godaddy.com
- Domain Status
- clientdeleteprohibited[more]
- Nameservers
- ns53.domaincontrol.com[more]
- DNSSEC
- unsigned
Tampaflcriminaldefenselawyers.com DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 3.33.152.147
@ IN A 15.197.142.173
AAAA Records
No AAAA records could be found.
MX Records
@ IN MX 0 smtp.secureserver.net
@ IN MX 10 mailstore1.secureserver.net
NS Records
@ IN NS ns53.domaincontrol.com
@ IN NS ns54.domaincontrol.com
TXT Records
No TXT records could be found.
SOA Record
@ IN SOA ns53.domaincontrol.com. dns.jomax.net
(
2021102000 ; serial
28800 ; refresh (8 hours)
7200 ; retry (2 hours)
604800 ; expire (7 days)
3600 ; minimum (1 hour)
)
Similar Domain Names like Tampaflcriminaldefenselawyers.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- tampaflcriminaldefenselawyers dot com
- https //tampaflcriminaldefenselawyers.com
- http //tampaflcriminaldefenselawyers.com
- tampaflcriminaldefenselawyers com
Tampaflcriminaldefenselawyers.com Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Tampaflcriminaldefenselawyers.com Demystified!
- Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
- Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
- Who is the registrar for the domain?
The domain has been registered at GoDaddy.com, LLC. You can visit the registrar's website at http://www.godaddy.com. The registrar's WHOIS server can be reached at whois.godaddy.com.
- What is the IP address?
The hostname resolves to the IPv4 addresses 3.33.152.147 and 15.197.142.173.
- When did the domain come out?
The domain was registered 4953 days ago on Monday, November 8, 2010.
- When has the domain expired?
This domain has expired 205 days ago on Wednesday, November 8, 2023.
- When was the last WHOIS update?
The WHOIS entry was last updated 632 days ago on Thursday, September 8, 2022.
- What are the domain's nameservers?
DNS is provided by the nameservers ns53.domaincontrol.com and ns54.domaincontrol.com.
- Where are the server locations?
The site has its servers located in the United States.