Wealthmaker.in
Global Traffic Rank
Safety/Trust
Child Safety
Registered
Visitors / Day*
Pageviews / Day*
Website Worth*
Revenue / Day*
About Wealthmaker.in
Wealthmaker.in is a financial website that offers a range of services including investment advice, financial planning, and wealth management. The website provides resources and tools for individuals looking to improve their financial situation and make informed decisions about their money. It also offers educational content on various financial topics such as saving, investing, and retirement planning. Wealthmaker.in aims to help users achieve their financial goals through personalized advice and guidance. The website holds a global ranking of 872,447 and is associated with the network IP address 122.180.112.161. It appears that The site is a safe and legit website.
Trace an Email Address
Wealthmaker.in Trust / Safety / Legit
Is wealthmaker.in legit & safe for all ages? Uncover trustworthiness & child safety. Don't fall for scams, ensure secure browsing now!
Trustworthiness
Child Safety
Pros & Cons
Positive Signals
- Very aged domain (17 years old)
Industry
- Finance/Banking
Similar Websites and Competitors to Wealthmaker.in
Top 15 similar sites to Wealthmaker.in. Explore these sites like Wealthmaker and find what you've been searching for!
- wealthmakerfinancialservices.com.au
- wealth-makers.com
- clientfol.io
- cafeconceptsinc.com
- fabasoft.com
- anindia.com
- bajajauto.co.in
- soaring-eagle.org
- bajajcapitalinsurance.com
- justtrade.in
- bajajcapitalone.com
- onebajaj.capital
- dgcmembers.com
- jobzton.com
- anjaliinvestment.com
Wealthmaker.in Global Traffic Rank History
Explore the website's historical data on Global Traffic Rank and track its ranking trends over time.
Wealthmaker.in Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
India
Wealthmaker.in Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
Wealth Maker
Website Host
Main Language
n/a
Inbound Links
77
Wealthmaker.in Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
Wealthmaker.in WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
Domain Registered
Domain Updated
Domain Expiry
WHOIS Server
Domain Status
Nameservers
DNSSEC
Wealthmaker.in DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 122.180.112.161
AAAA Records
No AAAA records could be found.
MX Records
@ IN MX 10 mail.rediffmailpro.com
NS Records
@ IN NS ns.rediffmailpro.com
@ IN NS ns2.rediffmailpro.com
TXT Records
@ IN TXT "1b26bbmwqybzbwsxx0jw1myqr2nmvbpn"
@ IN TXT "2grjw4b53stx9j2ylm340qg2bqr72hlb"
@ IN TXT "4vdhsq2jt737chhrkmrh66l6m38z3t7s"
@ IN TXT "xs6wh5ympwpq8qjyh14qv5pbzqc6n820"
SOA Record
@ IN SOA wealthmaker.in. domainadmin.rediff.com
(
0 ; serial
28800 ; refresh (8 hours)
7200 ; retry (2 hours)
3600000 ; expire (41 days, 16 hours)
21600 ; minimum (6 hours)
)
Similar Domain Names like Wealthmaker.in
Websites with similar domain names, indicating related or similar web addresses.
Similar Traffic Rank like Wealthmaker.in
Websites that have comparable levels of popularity or visitor traffic.
- wealth-mall.shop 872445
- wealthgenics.com 872446
- wealthmaker.in 872447
- wealthyguard.com 872448
- weareappa.com 872449
Related Keywords
Explore related keywords for the domain name in search engines.
- https //wealthmaker.in
- http //wealthmaker.in
- wealthmaker dot in
- wealthmaker in
Wealthmaker in Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Wealthmaker.in Demystified!
Is the site safe, legit and trustworthy?
According to our analysis the site is safe, legit and trustworthy. We haven't found any negative signals.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
Who is the registrar for the domain?
The domain has been registered at Rediff.com India Limited. You can visit the registrar's website at http://www.rediff.co.in.
What is the IP address?
The hostname resolves to the IPv4 address 122.180.112.161.
When did the domain come out?
The domain was registered 6338 days ago on Wednesday, December 20, 2006.
When will the domain expire?
This domain will expire in 966 days on Sunday, December 20, 2026.
When was the last WHOIS update?
The WHOIS entry was last updated 881 days ago on Sunday, November 28, 2021.
What are the domain's nameservers?
DNS is provided by the nameservers ns.rediffmailpro.com and ns2.rediffmailpro.com.
What is the domain's traffic rank?
The site ranks 872,447 globally.
How many people visit the site each day?
The site receives approximately 8.1 Thousand visitors and 56 Thousand page impressions per day.
Where are the server locations?
The site has its servers located in India.
What webserver software is used?
The website is powered by "Microsoft-IIS/7.5" webserver.