www.kerepesigyermekekertalapitvany.hu
Top-level Domain
Server Location
IP Addresses
About www.kerepesigyermekekertalapitvany.hu
The website www.kerepesigyermekekertalapitvany.hu is the official site for the Kerepesi Gyermekért Alapítvány, a Hungarian foundation dedicated to providing support and resources for children in need. The foundation offers various programs and services aimed at improving the lives of underprivileged children, including educational support, healthcare assistance, and recreational activities. The website serves as a platform for sharing information about the foundation's mission, projects, and ways for the public to get involved or donate to their cause. The website is associated with the network IP address 193.32.233.63.
Trace an Email Address
www.Kerepesigyermekekertalapitvany.hu Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
Hungary
www.Kerepesigyermekekertalapitvany.hu Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
Home | Kerepesi Gyermekekért Közhasznú Alapítvány
Website Host
Main Language
n/a
Inbound Links
n/a
www.Kerepesigyermekekertalapitvany.hu Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
www.Kerepesigyermekekertalapitvany.hu DNS Resource Records
Unlock the full potential of the subdomain with a comprehensive review of its DNS configuration, including A, AAAA, CNAME, and TXT records.
A Records
www IN A 193.32.233.63
AAAA Records
No AAAA records could be found.
CNAME Records
www IN CNAME kerepesigyermekekertalapitvany.hu
TXT Records
www IN TXT "v=spf1 +a +mx +ip4:193.32.234.21 ~all"
Similar Domain Names like www.Kerepesigyermekekertalapitvany.hu
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- https //www.kerepesigyermekekertalapitvany.hu
- http //www.kerepesigyermekekertalapitvany.hu
Kerepesigyermekekertalapitvany Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - www.Kerepesigyermekekertalapitvany.hu Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
What is the IP address?
The hostname resolves to the IPv4 address 193.32.233.63.
Where are the server locations?
The site has its servers located in Hungary.
What webserver software is used?
The website is powered by "lighttpd/1.4.69" webserver.
