www.sewaperlengkapaneventsemarang.com
Top-level Domain
Server Location
IP Addresses
About www.sewaperlengkapaneventsemarang.com
www.sewaperlengkapaneventsemarang.com is a subdomain of Sewaperlengkapaneventsemarang.com. The hostname is associated with the IPv4 address 103.247.10.119, as well as the IPv6 address and 2001:df0:27b:2::8:4157. The site has its servers located in Indonesia and is run by the "LiteSpeed" webserver software.
Trace an Email Address
www.Sewaperlengkapaneventsemarang.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
Indonesia
www.Sewaperlengkapaneventsemarang.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
Pesona Tenda - Persewaan Perlengkapan Event Semarang
Website Host
Main Language
n/a
Inbound Links
n/a
www.Sewaperlengkapaneventsemarang.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
www.Sewaperlengkapaneventsemarang.com DNS Resource Records
Unlock the full potential of the subdomain with a comprehensive review of its DNS configuration, including A, AAAA, CNAME, and TXT records.
A Records
www IN A 103.247.10.119
AAAA Records
www IN AAAA 2001:df0:27b:2::8:4157
CNAME Records
www IN CNAME sewaperlengkapaneventsemarang.com
TXT Records
www IN TXT "v=spf1 +a +mx +ip4:103.247.10.117 ~all"
Similar Domain Names like www.Sewaperlengkapaneventsemarang.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- http //www.sewaperlengkapaneventsemarang.com
- https //www.sewaperlengkapaneventsemarang.com
Sewaperlengkapaneventsemarang Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - www.Sewaperlengkapaneventsemarang.com Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
What is the IP address?
The hostname resolves to the IP addresses 103.247.10.119 and 2001:df0:27b:2::8:4157.
Where are the server locations?
The site has its servers located in Indonesia.
What webserver software is used?
The website is powered by "LiteSpeed" webserver.