www.sewaperlengkapaneventsemarang.com

Top-level Domain

.com
generic TLD

Server Location

1 location
1 country

IP Addresses

1 x IPv4
1 x IPv6
Information on this page was last updated on

About www.sewaperlengkapaneventsemarang.com

www.sewaperlengkapaneventsemarang.com is a subdomain of Sewaperlengkapaneventsemarang.com. The hostname is associated with the IPv4 address 103.247.10.119, as well as the IPv6 address and 2001:df0:27b:2::8:4157. The site has its servers located in Indonesia and is run by the "LiteSpeed" webserver software.

Trace an Email Address

www.Sewaperlengkapaneventsemarang.com Server Location

Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!

Flag of IndonesiaIndonesia

www.Sewaperlengkapaneventsemarang.com Website Information

Uncover the website's purpose and content, complemented by relevant focus keywords.

www.Sewaperlengkapaneventsemarang.com Web Server

Discover essential Web Server Information: server software, page load time, and website language at your fingertips!

Webserver Software

LiteSpeed

Median Page Load Time

n/a

www.Sewaperlengkapaneventsemarang.com DNS Resource Records

Unlock the full potential of the subdomain with a comprehensive review of its DNS configuration, including A, AAAA, CNAME, and TXT records.

A Records

www  IN  A  103.247.10.119

AAAA Records

www  IN  AAAA  2001:df0:27b:2::8:4157

CNAME Records

www  IN  CNAME  sewaperlengkapaneventsemarang.com

TXT Records

www  IN  TXT  "v=spf1 +a +mx +ip4:103.247.10.117 ~all"

Similar Domain Names like www.Sewaperlengkapaneventsemarang.com

Websites with similar domain names, indicating related or similar web addresses.

Related Keywords

Explore related keywords for the domain name in search engines.

  • http //www.sewaperlengkapaneventsemarang.com
  • https //www.sewaperlengkapaneventsemarang.com

Sewaperlengkapaneventsemarang Frequently Asked Questions (FAQ)

Unveiling the Most Asked Questions - www.Sewaperlengkapaneventsemarang.com Demystified!