wwwkhylalpinstagram-engikneerirg.emochila.com
Domain
Top-level Domain
Server Location
IP Addresses
About wwwkhylalpinstagram-engikneerirg.emochila.com
wwwkhylalpinstagram-engikneerirg.emochila.com is a subdomain of Emochila.com. The hostname is associated with the IPv4 address 54.186.178.19. The site has its servers located in the United States and is run by the "Apache" webserver software.
Trace an Email Address
wwwkhylalpinstagram-engikneerirg.Emochila.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
United States
wwwkhylalpinstagram-engikneerirg.Emochila.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Title
Login to Web Builder CS
Website Host
Main Language
n/a
Inbound Links
n/a
wwwkhylalpinstagram-engikneerirg.Emochila.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
wwwkhylalpinstagram-engikneerirg.Emochila.com DNS Resource Records
Unlock the full potential of the subdomain with a comprehensive review of its DNS configuration, including A, AAAA, CNAME, and TXT records.
A Records
wwwkhylalpinstagram-engikneerirg IN A 54.186.178.19
AAAA Records
No AAAA records could be found.
CNAME Records
wwwkhylalpinstagram-engikneerirg IN CNAME wbcs.cpasitesolutions.com
TXT Records
No TXT records could be found.
Similar Domain Names like wwwkhylalpinstagram-engikneerirg.Emochila.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- https //wwwkhylalpinstagram-engikneerirg.emochila.com
- http //wwwkhylalpinstagram-engikneerirg.emochila.com
Wwwkhylalpinstagram-Engikneerirg Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - wwwkhylalpinstagram-engikneerirg.Emochila.com Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
What is the IP address?
The hostname resolves to the IPv4 address 54.186.178.19.
Where are the server locations?
The site has its servers located in the United States.
What webserver software is used?
The website is powered by "Apache" webserver.