wwwkhylalpinstagram-engikneerirg.emochila.com

Top-level Domain

.com
generic TLD

Server Location

1 location
1 country

IP Addresses

1 x IPv4
0 x IPv6
Information on this page was last updated on

About wwwkhylalpinstagram-engikneerirg.emochila.com

wwwkhylalpinstagram-engikneerirg.emochila.com is a subdomain of Emochila.com. The hostname is associated with the IPv4 address 54.186.178.19. The site has its servers located in the United States and is run by the "Apache" webserver software.

Trace an Email Address

wwwkhylalpinstagram-engikneerirg.Emochila.com Server Location

Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!

Flag of the United StatesUnited States

wwwkhylalpinstagram-engikneerirg.Emochila.com Website Information

Uncover the website's purpose and content, complemented by relevant focus keywords.

wwwkhylalpinstagram-engikneerirg.Emochila.com Web Server

Discover essential Web Server Information: server software, page load time, and website language at your fingertips!

Webserver Software

Apache

Median Page Load Time

n/a

wwwkhylalpinstagram-engikneerirg.Emochila.com DNS Resource Records

Unlock the full potential of the subdomain with a comprehensive review of its DNS configuration, including A, AAAA, CNAME, and TXT records.

A Records

wwwkhylalpinstagram-engikneerirg  IN  A  54.186.178.19

AAAA Records

No AAAA records could be found.

CNAME Records

wwwkhylalpinstagram-engikneerirg  IN  CNAME  wbcs.cpasitesolutions.com

TXT Records

No TXT records could be found.

Similar Domain Names like wwwkhylalpinstagram-engikneerirg.Emochila.com

Websites with similar domain names, indicating related or similar web addresses.

Related Keywords

Explore related keywords for the domain name in search engines.

  • https //wwwkhylalpinstagram-engikneerirg.emochila.com
  • http //wwwkhylalpinstagram-engikneerirg.emochila.com

Wwwkhylalpinstagram-Engikneerirg Frequently Asked Questions (FAQ)

Unveiling the Most Asked Questions - wwwkhylalpinstagram-engikneerirg.Emochila.com Demystified!

See also

Subdomain List Page #339