Ziggyschimneysweeprepairservice.com
- Global Traffic Rank
- > 1M
- Safety/Trust
- Unknown
- Child Safety
- Unknown
- Registered
- Feb 2023
- 1 year old
- Visitors / Day*
- Unknown
- Pageviews / Day*
- Unknown
- Website Worth*
- Unknown
- Revenue / Day*
- Unknown
About Ziggyschimneysweeprepairservice.com
The domain Ziggyschimneysweeprepairservice.com belongs to the generic Top-level domain .com. It is associated with the IPv4 addresses 185.230.63.107, 185.230.63.171 and 185.230.63.186. The domain has been registered 1 year ago with Wix.com Ltd. on Feb 2023. The site has its servers located in the United States.
Trace an Email Address
Ziggyschimneysweeprepairservice.com Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
Ziggyschimneysweeprepairservice.com Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
- Title
- CALI CHIMNEY SERVICE
- Keywords
- deserve
- quality
- prices
- need
- The
- Website Host
- https://www.ziggyschimneysweeprepairservice.com
- Main Language
- n/a
- Inbound Links
- n/a
Ziggyschimneysweeprepairservice.com Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
- Webserver Software
- n/a
- Median Page Load Time
- n/a
Ziggyschimneysweeprepairservice.com WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
- Domain Registered
- FeFuU#Sb 277m, 20=/!023
u. - 1 year, 3 months and 7 days ago
- Domain Updated
- NoVK*qA^o+2n0)v 23q~[, 20
0)@xZW23 - 6 months and 13 days ago
- Domain Expiry
- FUj&=1"#T=gRAeb 2s.7b=)P]JkoYz8.,P7Ln#}MHK 2sF>&.0
v}[Nu;,2(JYV{Iir5 - in 8 months and 21 days
- Registrar
- Wix.com Ltd.
- http://www.wix.com
- WHOIS Server
- whois.wix.com
- Domain Status
- clienttransferprohibited[more]
- Nameservers
- ns14.wixdns.net[more]
- DNSSEC
- unsigned
Ziggyschimneysweeprepairservice.com DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 185.230.63.107
@ IN A 185.230.63.171
@ IN A 185.230.63.186
AAAA Records
No AAAA records could be found.
MX Records
No MX records could be found.
NS Records
@ IN NS ns14.wixdns.net
@ IN NS ns15.wixdns.net
TXT Records
No TXT records could be found.
SOA Record
@ IN SOA ns14.wixdns.net. support.wix.com
(
2023112318 ; serial
10800 ; refresh (3 hours)
3600 ; retry (1 hour)
604800 ; expire (7 days)
3600 ; minimum (1 hour)
)
Similar Domain Names like Ziggyschimneysweeprepairservice.com
Websites with similar domain names, indicating related or similar web addresses.
Related Keywords
Explore related keywords for the domain name in search engines.
- the
- -
- ziggyschimneysweeprepairservice com
- http //ziggyschimneysweeprepairservice.com
- https //ziggyschimneysweeprepairservice.com
Ziggyschimneysweeprepairservice.com Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Ziggyschimneysweeprepairservice.com Demystified!
- Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
- Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
- Who is the registrar for the domain?
The domain has been registered at Wix.com Ltd. You can visit the registrar's website at http://www.wix.com. The registrar's WHOIS server can be reached at whois.wix.com.
- What is the IP address?
The hostname resolves to the following 3 IPv4 addresses:
- 185.230.63.107
- 185.230.63.171
- 185.230.63.186
- When did the domain come out?
The domain was registered 464 days ago on Monday, February 27, 2023.
- When will the domain expire?
This domain will expire in 266 days on Thursday, February 27, 2025.
- When was the last WHOIS update?
The WHOIS entry was last updated 195 days ago on Thursday, November 23, 2023.
- What are the domain's nameservers?
DNS is provided by the nameservers ns14.wixdns.net and ns15.wixdns.net.
- Where are the server locations?
The site has its servers located in the United States.